PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr009709.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 459aa    MW: 51795.6 Da    PI: 6.3261
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr009709.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS442.52.9e-135444551374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL++cA +v+sg+ e+a+  L ++s+laspdgd+mqR+aayfteALa+r+++ +++l kal++++ s  ++see+ +++lf++++P+lk++++++
  Pbr009709.1  44 LIQLLYACASHVTSGSIEKANFWLDQISQLASPDGDSMQRIAAYFTEALANRMLKCWPGLHKALHSTKIS--SVSEEIIVQRLFFDLCPFLKVAYVVT 139
                  689*************************************************************999987..5************************* PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaI+ea+ege++vHiiD+   +++QW++L+q+L++Rpegpp+lRiTg+++    +ke l ++  +L++ A +l++pf+fn+ ++++le+l++e+Lrv
  Pbr009709.1 140 NQAIVEAMEGEKMVHIIDLHSCEPAQWINLIQTLNARPEGPPHLRITGINE----QKEVLDQMFLQLTEEAGNLNIPFQFNA-IVSKLENLDIESLRV 232
                  ***************************************************....9**************************.7999*********** PP

         GRAS 197 kpgEalaVnlvlqlhrll...............................................desvsleserdevLklvkslsPkvvvvveqead 247
                  k+gEala+++vlqlh++l                                                +++s +s++ ++L  +++lsPk++v++eqea+
  Pbr009709.1 233 KTGEALAICSVLQLHSFLasdddqrrksplasknlqkvlhmnkltlgewlekdpisaynlspdtaWSPLSGASPTGSFLTSLWGLSPKLMVITEQEAN 330
                  **************************************************************999889999999************************ PP

         GRAS 248 hnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                  hn++++++r++eal++y alfd+le++++r+  er+kvE++l+g+ei+n++aceg+errerhe+lekW  rle aGF++vpls++ + qa+  lr ++
  Pbr009709.1 331 HNGHTLMDRIMEALHFYGALFDCLESTVSRAPMERQKVEKMLFGEEIKNIIACEGTERRERHEKLEKWILRLELAGFGKVPLSYNGMLQARGFLRGYD 428
                  *************************************************************************************************9 PP

         GRAS 346 sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    gy+++ee+g+++++W+drpL+++S Wr
  Pbr009709.1 429 --GYKIKEENGCVFICWHDRPLFTISGWR 455
                  ..**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.39218437IPR005202Transcription factor GRAS
PfamPF035141.0E-13244455IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MAQEDGSPVT SSPLQFFPWL SPGMGSPYSP WLRELKSEER GLCLIQLLYA CASHVTSGSI  60
EKANFWLDQI SQLASPDGDS MQRIAAYFTE ALANRMLKCW PGLHKALHST KISSVSEEII  120
VQRLFFDLCP FLKVAYVVTN QAIVEAMEGE KMVHIIDLHS CEPAQWINLI QTLNARPEGP  180
PHLRITGINE QKEVLDQMFL QLTEEAGNLN IPFQFNAIVS KLENLDIESL RVKTGEALAI  240
CSVLQLHSFL ASDDDQRRKS PLASKNLQKV LHMNKLTLGE WLEKDPISAY NLSPDTAWSP  300
LSGASPTGSF LTSLWGLSPK LMVITEQEAN HNGHTLMDRI MEALHFYGAL FDCLESTVSR  360
APMERQKVEK MLFGEEIKNI IACEGTERRE RHEKLEKWIL RLELAGFGKV PLSYNGMLQA  420
RGFLRGYDGY KIKEENGCVF ICWHDRPLFT ISGWRSRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-41444554375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009368102.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_009368100.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLM5WZE40.0M5WZE4_PRUPE; Uncharacterized protein
STRINGVIT_13s0019g01220.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23833484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3